| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protachykinin-1 |
|---|
| Ligand | BDBM50252513 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 1000±n/a nM |
|---|
| Comments | PDSP_1600 |
|---|
| Citation |  Schotte, A; Janssen, PF; Gommeren, W; Luyten, WH; Van Gompel, P; Lesage, AS; De Loore, K; Leysen, JE Risperidone compared with new and reference antipsychotic drugs: in vitro and in vivo receptor binding. Psychopharmacology (Berl)124:57-73 (1996) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Protachykinin-1 |
|---|
| Name: | Protachykinin-1 |
|---|
| Synonyms: | NKA | NKNA | Protachykinin-1 | Substance P | TAC1 | TAC2 | TKN1_HUMAN |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 15006.99 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Substance P 0 HUMAN::P20366 |
|---|
| Residue: | 129 |
|---|
| Sequence: | MKILVALAVFFLVSTQLFAEEIGANDDLNYWSDWYDSDQIKEELPEPFEHLLQRIARRPK
PQQFFGLMGKRDADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLMGKRALNSVAYERS
AMQNYERRR
|
|
|
|---|
| BDBM50252513 |
|---|
| n/a |
|---|
| Name | BDBM50252513 |
|---|
| Synonyms: | 3-(2-(4-(6-fluorobenzo[d]isoxazol-3-yl)piperidin-1-yl)ethyl)-9-hydroxy-2-methyl-6,7,8,9-tetrahydropyrido[1,2-a]pyrimidin-4-one | 9-OH-risperidone | 9-hydroxy risperidone | CHEMBL1621 | Invega | PALIPERIDONE |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H27FN4O3 |
|---|
| Mol. Mass. | 426.4839 |
|---|
| SMILES | Cc1nc2C(O)CCCn2c(=O)c1CCN1CCC(CC1)c1noc2cc(F)ccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
