Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCNR1
LigandBDBM22988
Substrate/Competitorn/a
Ki 33.3±n/a nM
CommentsPDSP_301
Citation Stefano GBSalzet BSalzet M Identification and characterization of the leech CNS cannabinoid receptor: coupling to nitric oxide release. Brain Res 753:219-24 (1997) [PubMed]  Article
More Info.:Get all data from this article
 
CNR1
Name:CNR1
Synonyms:CANNABINOID CB1
Type:Enzyme Catalytic Domain
Mol. Mass.:22425.67
Organism:theromyzon Tessulatum
Description:CANNABINOID CB1 CNR1 theromyzon Tessulatum::A0A0V1DID4
Residue:196
Sequence:
MDTMTMETLLLSSTLLLLPFNKHGGAKLAGWLVNDLPRRRIMKPPSRFEVHIRFCCLKPE
NAETTFKVDGRRFNMSTKTLKLYRDTTYRIGVTSSPPMEFEEAEINGENLISHLEPDGGI
EADWSTAGFSKTKSRSRCNIRLMLRGVFGSVTQDLQCKFYDISDPHAQWGDKFRQMVLVC
STYDDCMINVVEVELK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22988
n/a
NameBDBM22988
Synonyms:(5Z,8Z,11Z,14Z)-N-(2-hydroxyethyl)icosa-5,8,11,14-tetraenamide | AEA | ANANDAMIDE | Arachidonoyl ethanolamide | Arachidonoyl ethanolamide (AEA) | Arachidonoylethanolamide (AEA) | Arachidonylethanolamide | CHEMBL15848 | [14C]Anandamide | [3H]Anandamide
Typeradiolabeled substrate
Emp. Form.C22H37NO2
Mol. Mass.347.5347
SMILESCCCCC\C=C/C\C=C/C\C=C/C\C=C/CCCC(=O)NCCO
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: