Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCNR1
LigandBDBM21281
Substrate/Competitorn/a
Ki 62.4±n/a nM
CommentsPDSP_1966
Citation Stefano GBSalzet BSalzet M Identification and characterization of the leech CNS cannabinoid receptor: coupling to nitric oxide release. Brain Res 753:219-24 (1997) [PubMed]  Article
More Info.:Get all data from this article
 
CNR1
Name:CNR1
Synonyms:CANNABINOID CB1
Type:Enzyme Catalytic Domain
Mol. Mass.:44900.17
Organism:Hirudo medicinalis
Description:CANNABINOID CB1 CNR1 Hirudo medicinalis::A0A0H4AWC7
Residue:396
Sequence:
PYLGSNDIQYEDIKSDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITE
FYNKSLSSYKENEENIQCGENFMDMECFMILNPSQQLAIAVLSLTLGTFTVLENLLVLCV
ILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFVDFHVFHRKDSPNVFLFKLGGVTASF
TASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCKKL
QSVCSDIFPLIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIH
TSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFA
FCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21281
n/a
NameBDBM21281
Synonyms:(11R)-2-methyl-11-(morpholin-4-ylmethyl)-3-(naphthalen-1-ylcarbonyl)-9-oxa-1-azatricyclo[6.3.1.0^{4,12}]dodeca-2,4(12),5,7-tetraene | (2,3-dihydro-5-methyl-3-((4-morpholinyl)methyl)pyrrolo-(1,2,3-de)-1,4-benzoxazin-6-yl)(1-naphthalenyl)methanone monomethanesulfonat | CHEMBL188 | WIN 55,212-2 | WIN 55212-2 | WIN-55212 | WIN55212-2
TypeAnalgesic
Emp. Form.C27H26N2O3
Mol. Mass.426.5069
SMILESCc1c(C(=O)c2cccc3ccccc23)c2cccc3OC[C@@H](CN4CCOCC4)n1c23 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: