| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Leukotriene B4 receptor 2 |
|---|
| Ligand | BDBM85082 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 190±n/a nM |
|---|
| Comments | PDSP_43 |
|---|
| Citation |  Yokomizo, T; Izumi, T; Chang, K; Takuwa, Y; Shimizu, T A G-protein-coupled receptor for leukotriene B4 that mediates chemotaxis. Nature387:620-4 (1997) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Leukotriene B4 receptor 2 |
|---|
| Name: | Leukotriene B4 receptor 2 |
|---|
| Synonyms: | BLT2R | BLTR2 | LT4R2_HUMAN | LTB4 receptor JULF2 | LTB4-R 2 | LTB4-R2 | LTB4R2 | LTB4R2 protein | Leukotriene B4 | Leukotriene B4 R2 | Leukotriene B4 receptor | Leukotriene B4 receptor 2 | Leukotriene B4 receptor BLT2 | Leukotriene b1 | Seven transmembrane receptor BLTR2 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 37964.86 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Leukotriene 2 0 HUMAN::Q9NPC1 |
|---|
| Residue: | 358 |
|---|
| Sequence: | MSVCYRPPGNETLLSWKTSRATGTAFLLLAALLGLPGNGFVVWSLAGWRPARGRPLAATL
VLHLALADGAVLLLTPLFVAFLTRQAWPLGQAGCKAVYYVCALSMYASVLLTGLLSLQRC
LAVTRPFLAPRLRSPALARRLLLAVWLAALLLAVPAAVYRHLWRDRVCQLCHPSPVHAAA
HLSLETLTAFVLPFGLMLGCYSVTLARLRGARWGSGRHGARVGRLVSAIVLAFGLLWAPY
HAVNLLQAVAALAPPEGALAKLGGAGQAARAGTTALAFFSSSVNPVLYVFTAGDLLPRAG
PRFLTRLFEGSGEARGGGRSREGTMELRTTPQLKVVGQGRGNGDPGGGMEKDGPEWDL
|
|
|
|---|
| BDBM85082 |
|---|
| n/a |
|---|
| Name | BDBM85082 |
|---|
| Synonyms: | 20-COOH-LTB4 | CAS_128572 | NSC_128572 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H32O6 |
|---|
| Mol. Mass. | 380.4752 |
|---|
| SMILES | OC(CCCC(O)=O)C=CC=CC=CC(O)CC=CCCCCCC(O)=O |w:18.18,13.13,11.11,9.9| |
|---|
| Structure | 
|
|---|
Search and Browse
