| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptidyl-prolyl cis-trans isomerase A |
|---|
| Ligand | BDBM85119 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | PPIase Assay |
|---|
| Ki | 2.070e+5± 5.78e+4 nM |
|---|
| Citation |  Dunsmore, CJ; Malone, KJ; Bailey, KR; Wear, MA; Florance, H; Shirran, S; Barran, PE; Page, AP; Walkinshaw, MD; Turner, NJ Design and synthesis of conformationally constrained cyclophilin inhibitors showing a cyclosporin-A phenotype in C. elegans. Chembiochem12:802-10 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptidyl-prolyl cis-trans isomerase A |
|---|
| Name: | Peptidyl-prolyl cis-trans isomerase A |
|---|
| Synonyms: | CYPA | CYPA PPIase | Cyclophilin A | Cyclosporin A-binding protein | PPIA | PPIA_HUMAN | PPIase A | Peptidyl-prolyl cis-trans isomerase A | Rotamase A |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 18015.32 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P62937 |
|---|
| Residue: | 165 |
|---|
| Sequence: | MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGF
MCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTE
WLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
|
|
|
|---|
| BDBM85119 |
|---|
| n/a |
|---|
| Name | BDBM85119 |
|---|
| Synonyms: | Cyclophilin Inhibitor, 3e |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C30H38N2O6S |
|---|
| Mol. Mass. | 554.698 |
|---|
| SMILES | COC(=O)[C@H](CCCCNS(=O)(=O)c1cccc2c(cccc12)N(C)C)C1C(=O)CC2C1=CC(=O)CC2(C)C |r,t:34| |
|---|
| Structure | 
|
|---|
Search and Browse
