Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M2
LigandBDBM50060582
Substrate/Competitorn/a
Ki 25±n/a nM
CommentsPDSP_632
Citation Kovacs IYamamura HIWaite SLVarga EVRoeske WR Pharmacological comparison of the cloned human and rat M2 muscarinic receptor genes expressed in the murine fibroblast (B82) cell line. J Pharmacol Exp Ther 284:500-7 (1998) [PubMed]  Article
More Info.:Get all data from this article
 
Muscarinic acetylcholine receptor M2
Name:Muscarinic acetylcholine receptor M2 and M5
Synonyms:CHRM2 | Cholinergic, muscarinic M2 | RecName: Full=Muscarinic acetylcholine receptor M2
Type:GPCR
Mol. Mass.:51730.61
Organism:Homo sapiens (Human)
Description:P08172
Residue:466
Sequence:
MNNSTNSSNNSLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY
FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD
RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF
FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKDKKEPVANQDPVSPSLVQGRI
VKPNNNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSVSAVASNMRDDE
ITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKSDSCTPTNTTVEVVGSSGQNGDEKQNI
VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50060582
n/a
NameBDBM50060582
Synonyms:1,10-Bis(trimethyl ammonium)decane dibromide | 1,10-bis-(trimethyl ammonium) decane dibromide | CHEMBL1134 | DECAMETHONIUM | DECAMETHONIUM BROMIDE | Decamethonium Iodide | N,N,N'',N''-Tetramethyl-decane-1,10-diammonium; dibromide | N,N,N,N'',N'',N''-Hexamethyldecane-1,10-diammoniumdibromide | Syncurine | decane-1,10-bis(trimethylammonium bromide)
TypeSmall organic molecule
Emp. Form.C16H38N2
Mol. Mass.258.4852
SMILESC[N+](C)(C)CCCCCCCCCC[N+](C)(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: