Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(3) dopamine receptor
LigandBDBM50005120
Substrate/Competitorn/a
Ki 0.2±n/a nM
CommentsPDSP_1981
Citation Toll LBerzetei-Gurske IPPolgar WEBrandt SRAdapa IDRodriguez LSchwartz RWHaggart DO'Brien AWhite AKennedy JMCraymer KFarrington LAuh JS Standard binding and functional assays related to medications development division testing for potential cocaine and opiate narcotic treatment medications. NIDA Res Monogr 178:440-66 (1998) [PubMed]
More Info.:Get all data from this article
 
D(3) dopamine receptor
Name:D(3) dopamine receptor
Synonyms:D2-like dopamine receptor | DOPAMINE D3 | DRD3 | Dopamine D3 receptor | Dopamine D3 receptor (D3) | Dopamine D3 receptor (D3R) | Dopamine receptor | Dopamine receptor (D3) | Dopamine receptor D3
Type:n/a
Mol. Mass.:44243.43
Organism:Homo sapiens (Human)
Description:n/a
Residue:400
Sequence:
MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERAL
QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN
LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTV
CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQ
QTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRK
LSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHV
SPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50005120
n/a
NameBDBM50005120
Synonyms:CHEMBL274491 | N-((2S,3S)-1-Benzyl-2-methyl-pyrrolidin-3-yl)-5-chloro-2-methoxy-4-methylamino-benzamide | N-(1-Benzyl-2-methyl-pyrrolidin-3-yl)-5-chloro-2-methoxy-4-methylamino-benzamide | Nemonapride | YM-09151-2
TypeSmall organic molecule
Emp. Form.C21H26ClN3O2
Mol. Mass.387.903
SMILESCNc1cc(OC)c(cc1Cl)C(=O)N[C@H]1CCN(Cc2ccccc2)[C@H]1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: