| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM82553 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 12.8±n/a nM |
|---|
| Comments | PDSP_362 |
|---|
| Citation |  Toll, L; Berzetei-Gurske, IP; Polgar, WE; Brandt, SR; Adapa, ID; Rodriguez, L; Schwartz, RW; Haggart, D; O'Brien, A; White, A; Kennedy, JM; Craymer, K; Farrington, L; Auh, JS Standard binding and functional assays related to medications development division testing for potential cocaine and opiate narcotic treatment medications. NIDA Res Monogr178:440-66 (1998) [PubMed] |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40382.98 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
|---|
| Residue: | 372 |
|---|
| Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
|---|
| BDBM82553 |
|---|
| n/a |
|---|
| Name | BDBM82553 |
|---|
| Synonyms: | BETA-FUNALTREXAMINE | CAS_72786-10-8 | b-FNA-HCl |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H30N2O6 |
|---|
| Mol. Mass. | 454.5155 |
|---|
| SMILES | COC(=O)\C=C\C(=O)NC1CC[C@]2(O)[C@H]3Cc4ccc(O)c5O[C@@H]1[C@]2(CCN3CC1CC1)c45 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
