Reaction Details |
| Report a problem with these data |
Target | Delta-type opioid receptor |
---|
Ligand | BDBM21025 |
---|
Substrate/Competitor | n/a |
---|
Ki | 0.3±n/a nM |
---|
Comments | PDSP_615 |
---|
Citation | Toll, L; Berzetei-Gurske, IP; Polgar, WE; Brandt, SR; Adapa, ID; Rodriguez, L; Schwartz, RW; Haggart, D; O'Brien, A; White, A; Kennedy, JM; Craymer, K; Farrington, L; Auh, JS Standard binding and functional assays related to medications development division testing for potential cocaine and opiate narcotic treatment medications. NIDA Res Monogr178:440-66 (1998) [PubMed] |
---|
More Info.: | Get all data from this article |
---|
|
Delta-type opioid receptor |
---|
Name: | Delta-type opioid receptor |
Synonyms: | Delta opioid receptor | Delta-type opioid receptor | OPIATE Delta | OPRD1 | OPRD_PIG |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25736.90 |
Organism: | GUINEA PIG |
Description: | OPIATE Delta OPRD1 GUINEA PIG::P79291 |
Residue: | 228 |
Sequence: | GIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNM
FTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTRPR
DGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILVITVCYGLMLLRLRSVRLLSGSKEK
DRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
|
|
|
BDBM21025 |
---|
n/a |
---|
Name | BDBM21025 |
Synonyms: | (2R)-2-[(2S)-2-{2-[(2R)-2-[(2S)-2-amino-3-(4-hydroxyphenyl)propanamido]propanamido]acetamido}-3-phenylpropanamido]-4-methylpentanoic acid | (D-Ala2,D-Leu5)-Enkephalin | BW-180C | CHEMBL340032 | DADLE | DADLE-OH | H-Tyr-D-Ala-Gly-Phe-D-Leu-OH | [D-Ala2-D-Leu5]enkephalin |
Type | ANALGESIC |
Emp. Form. | C29H39N5O7 |
Mol. Mass. | 569.6493 |
SMILES | CC(C)C[C@@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)CNC(=O)[C@@H](C)NC(=O)[C@@H](N)Cc1ccc(O)cc1)C(O)=O |
Structure |
|