Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPTGFR
LigandBDBM50150899
Substrate/Competitorn/a
Ki 4200±n/a nM
CommentsPDSP_1059
Citation Sharif NAXu SXWilliams GWCrider JYGriffin BWDavis TL Pharmacology of [3H]prostaglandin E1/[3H]prostaglandin E2 and [3H]prostaglandin F2alpha binding to EP3 and FP prostaglandin receptor binding sites in bovine corpus luteum: characterization and correlation with functional data. J Pharmacol Exp Ther 286:1094-102 (1998) [PubMed]  Article
More Info.:Get all data from this article
 
PTGFR
Name:Prostanoid FP receptor
Synonyms:PGF receptor | PGF2 alpha receptor | ProstaglandinF2Alpha
Type:Enzyme Catalytic Domain
Mol. Mass.:41044.75
Organism:BOVINE
Description:ProstaglandinF2Alpha PTGFR BOVINE::P37289
Residue:362
Sequence:
MSTNSSIQPVSPESELLSNTTCQLEEDLSISFSIIFMTVGILSNSLAIAILMKAYQRFRQ
KYKSSFLLLASALVITDFFGHLINGTIAVFVYASDKDWIYFDKSNILCSIFGICMVFSGL
CPLFLGSLMAIERCIGVTKPIFHSTKITTKHVKMMLSGVCFFAVFVALLPILGHRDYKIQ
ASRTWCFYKTDEIKDWEDRFYLLLFAFLGLLALGISFVCNAITGISLLKVKFRSQQHRQG
RSHHFEMVIQLLGIMCVSCICWSPFLVTMASIGMNIQDFKDSCERTLFTLRMATWNQILD
PWVYILLRKAVLRNLYVCTRRCCGVHVISLHVWELSSIKDSLKVAAISDLPVTEKVTQQT
ST
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50150899
n/a
NameBDBM50150899
Synonyms:(E)-7-[(1R,2R,3R,5S)-3,5-Dihydroxy-2-((R)-3-hydroxy-5-phenyl-pentyl)-cyclopentyl]-hept-5-enoic acid isopropyl ester | CHEMBL364375 | LATANOPROST (PHXA41) | Latanoprost (Isopropyl Ester)
TypeSmall organic molecule
Emp. Form.C26H40O5
Mol. Mass.432.5928
SMILESCC(C)OC(=O)CCC\C=C\C[C@H]1[C@@H](O)C[C@@H](O)[C@@H]1CC[C@@H](O)CCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: