| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Muscarinic acetylcholine receptor M4 |
|---|
| Ligand | BDBM50176065 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 1.31±n/a nM |
|---|
| Comments | PDSP_111 |
|---|
| Citation |  Chelala, JL; Kilani, A; Miller, MJ; Martin, RJ; Ernsberger, P Muscarinic receptor binding sites of the M4 subtype in porcine lung parenchyma. Pharmacol Toxicol83:200-7 (1998) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Muscarinic acetylcholine receptor M4 |
|---|
| Name: | Muscarinic acetylcholine receptor M4 |
|---|
| Synonyms: | CHRM4 | CHRM4 protein | Cholinergic, muscarinic M4 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 30028.84 |
|---|
| Organism: | bovine |
|---|
| Description: | A6QQE4 |
|---|
| Residue: | 271 |
|---|
| Sequence: | MTVLYVHISLASRSRVHKHRPEGPKEKKAKTLAFLKSPLMKQSVKKPPPPGDTTARGELR
NGKLEEAPPPVLPPPPRPMADKDTSNESSSGSATQNTKERPPTELSTTEATTPATPAPPL
QPRTLNPASKWSKIQIVTKQTGNECVTAIEIVPATPAGMRPAANVARKFASIARSQVRKK
RQMAARERKVTRTIFAILLAFILTWTPYNVMVLVNTFCQSCIPETVWSIGYWLCYVNSTI
NPACYALCNATFKKTFRHLLLCQYRNIGTAR
|
|
|
|---|
| BDBM50176065 |
|---|
| n/a |
|---|
| Name | BDBM50176065 |
|---|
| Synonyms: | 4-DAMP | 4-Diphenylacetoxy-1,1-dimethyl-piperidinium; iodide | Acetic acid 4-[(4-acetoxy-phenyl)-pyridin-2-yl-methyl]-phenyl ester | CHEMBL168067 | CHEMBL76897 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H26NO2 |
|---|
| Mol. Mass. | 324.4361 |
|---|
| SMILES | C[N+]1(C)CCC(CC1)OC(=O)C(c1ccccc1)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
