Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFibroblast growth factor receptor 1
LigandBDBM50001103
Substrate/Competitorn/a
Meas. Tech.MRC-5 Human Lung Fibroblasts Assay
EC50 55000±0 nM
Citation Hostetler KYBeadle JR Phosphonate compounds US Patent  US10071110 Publication Date 9/11/2018
More Info.:Get all data from this article,  Assay Method
 
Fibroblast growth factor receptor 1
Name:Fibroblast growth factor receptor 1
Synonyms:BFGFR | Basic fibroblast growth factor receptor 1 | Basic fibroblast growth factor receptor 1 (FGFR1) | CD_antigen=CD331 | FGFR-1 | FGFR-1 Tyrosine Kinase | FGFR-1, (FL) | FGFR1 | Fibroblast growth factor receptor (FGFR) | Fibroblast growth factor receptor 1 (FGFR-1) | Fibroblast growth factor receptor 1 (FGFR1) | Fms-like tyrosine kinase 2 | N-sam | bFGF-R | c-fgr
Type:Receptor
Mol. Mass.:91861.70
Organism:Homo sapiens (Human)
Description:P11362
Residue:822
Sequence:
MWSWKCLLFWAVLVTATLCTARPSPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDD
VQSINWLRDGVQLAESNRTRITGEEVEVQDSVPADSGLYACVTSSPSGSDTTYFSVNVSD
ALPSSEDDDDDDDSSSEEKETDNTKPNRMPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPS
SGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSIN
HTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKI
GPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLE
ALEERPAVMTSPLYLEIIIYCTGAFLISCMVGSVIVYKMKSGTKKSDFHSQMAVHKLAKS
IPLRRQVTVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVL
GKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGK
HKNIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDL
VSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNG
RLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMD
KPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSMPLDQYSPSF
PDTRSSTCSSGEDSVFSHEPLPEEPCLPRHPAQLANGGLKRR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50001103
n/a
NameBDBM50001103
Synonyms:(2-(6-amino-9H-purin-9-yl)ethoxy)methylphosphonic acid | (PMEA)[2-(6-Amino-purin-9-yl)-ethoxymethyl]-phosphonic acid | 9-(2-(phosphonomethoxy)ethyl)adenine | 9-[(2-phosphonylmethoxy)ethyl]adenine | 9-[2-(phosphonomethoxy)ethyl]adenine | 9-[2-phosphonomethoxyethyl]adenine | 9-[3-(Phosphonomethoxy)ethyl]adenine (PMEA) | ADEFOVIR | CHEMBL484 | GS-0393 | US10071110, Compound Adefovir | [2-(6-Amino-purin-9-yl)-ethoxymethyl]-phosphonic acid | [2-(6-Amino-purin-9-yl)-ethoxymethyl]-phosphonic acid(PMEA) | [2-(6-amino-9H-purin-9-yl)ethoxy]methylphosphonic acid | {[2-(6-AMINO-9H-PURIN-9-YL)ETHOXY]METHYL}PHOSPHONIC ACID
TypeSmall organic molecule
Emp. Form.C8H12N5O4P
Mol. Mass.273.1857
SMILESNc1ncnc2n(CCOCP(O)(O)=O)cnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: