Reaction Details |
| Report a problem with these data |
Target | Melatonin receptor type 1B |
---|
Ligand | BDBM85065 |
---|
Substrate/Competitor | n/a |
---|
Ki | 1737.8±n/a nM |
---|
Comments | PDSP_1123 |
---|
Citation | Teh, MT; Sugden, D Comparison of the structure-activity relationships of melatonin receptor agonists and antagonists: lengthening the N-acyl side-chain has differing effects on potency on Xenopus melanophores. Naunyn Schmiedebergs Arch Pharmacol358:522-8 (1998) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
Melatonin receptor type 1B |
---|
Name: | Melatonin receptor type 1B |
Synonyms: | MEL-1B-R | MTR1B_CHICK | Melatonin | Melatonin receptor | Melatonin receptor type 1B |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 33012.73 |
Organism: | Chick |
Description: | Melatonin 0 Chick::P51050 |
Residue: | 289 |
Sequence: | GNAFVVSLALADLVVALYPYPLVLLAIFHNGWTLGEMHCKVSGFVMGLSVIGSIFNITAI
AINRYCYICHSFAYDKVYSCWNTMLYVSLIWVLTVIATVPNFFVGSLKYDPRIYSCTFVQ
TASSYYTIAVVVIHFIVPITVVSFCYLRIWVLVLQVRRRVKSETKPRLKPSDFRNFLTMF
VVFVIFAFCWAPLNFIGLAVAINPSEMAPKVPEWLFIISYFMAYFNSCLNAIIYGLLNQN
FRNEYKRILMSLWMPRLFFQDTSKGGTDGQKSKPSPALNNNDQMKTDTL
|
|
|
BDBM85065 |
---|
n/a |
---|
Name | BDBM85065 |
Synonyms: | CAS_117946-91-5 | Luzindole | NSC_122162 |
Type | Small organic molecule |
Emp. Form. | C19H20N2O |
Mol. Mass. | 292.3749 |
SMILES | CC(=O)NCCc1c(Cc2ccccc2)[nH]c2ccccc12 |
Structure |
|