Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGALR1
LigandBDBM50307254
Substrate/Competitorn/a
Ki 2.40±n/a nM
CommentsPDSP_1162
Citation Borowsky BWalker MWHuang LYJones KASmith KEBard JBranchek TAGerald C Cloning and characterization of the human galanin GALR2 receptor. Peptides 19:1771-81 (1998) [PubMed]  Article
More Info.:Get all data from this article
 
GALR1
Name:GALR1
Synonyms:GAL1-R | Galanin R1 | Galanin receptor 1 | Galanin receptor type 1
Type:Enzyme Catalytic Domain
Mol. Mass.:38976.60
Organism:Homo sapiens (Human)
Description:Galanin R1 GALR1 HUMAN::P47211
Residue:349
Sequence:
MELAVGNLSEGNASWPEPPAPEPGPLFGIGVENFVTLVVFGLIFALGVLGNSLVITVLAR
SKPGKPRSTTNLFILNLSIADLAYLLFCIPFQATVYALPTWVLGAFICKFIHYFFTVSML
VSIFTLAAMSVDRYVAIVHSRRSSSLRVSRNALLGVGCIWALSIAMASPVAYHQGLFHPR
ASNQTFCWEQWPDPRHKKAYVVCTFVFGYLLPLLLICFCYAKVLNHLHKKLKNMSKKSEA
SKKKTAQTVLVVVVVFGISWLPHHIIHLWAEFGVFPLTPASFLFRITAHCLAYSNSSVNP
IIYAFLSENFRKAYKQVFKCHIRKDSHLSDTKESKSRIDTPPSTNCTHV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50307254
n/a
NameBDBM50307254
Synonyms:CHEMBL604990 | GWTLNSAGYLLGPPPALALA-CONH2 | M40
TypeSmall organic molecule
Emp. Form.C94H145N23O24
Mol. Mass.1981.2968
SMILESCC(C)C[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)CN)[C@@H](C)O)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(N)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: