Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGastrin releasing peptide receptor
LigandBDBM85488
Substrate/Competitorn/a
Ki 0.26±n/a nM
CommentsPDSP_745
Citation Katsuno TPradhan TKRyan RRMantey SAHou WDonohue PJAkeson MASpindel ERBattey JFCoy DHJensen RT Pharmacology and cell biology of the bombesin receptor subtype 4 (BB4-R). Biochemistry 38:7307-20 (1999) [PubMed]  Article
More Info.:Get all data from this article
 
Gastrin releasing peptide receptor
Name:Gastrin releasing peptide receptor
Synonyms:GRP-R | GRP-preferring bombesin receptor | Gastrin-releasing peptide receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:43234.59
Organism:MOUSE
Description:Gastrin-Releasing peptide 0 MOUSE::P21729
Residue:384
Sequence:
MAPNNCSHLNLDVDPFLSCNDTFNQSLSPPKMDNWFHPGFIYVIPAVYGLIIVIGLIGNI
TLIKIFCTVKSMRNVPNLFISSLALGDLLLLVTCAPVDASKYLADRWLFGRIGCKLIPFI
QLTSVGVSVFTLTALSADRYKAIVRPMDIQASHALMKICLKAALIWIVSMLLAIPEAVFS
DLHPFHVKDTNQTFISCAPYPHSNELHPKIHSMASFLVFYVIPLAIISVYYYFIARNLIQ
SAYNLPVEGNIHVKKQIESRKRLAKTVLVFVGLFAFCWLPNHVIYLYRSYHYSEVDTSML
HFVTSICARLLAFTNSCVNPFALYLLSKSFRKQFNTQLLCCQPGLMNRSHSTGRSTTCMT
SFKSTNPSATFSLINRNICHEGYV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM85488
n/a
NameBDBM85488
Synonyms:DPhe6,BetaAla11,Phe13,Nle14-Bn(6-14)
TypeSmall organic molecule
Emp. Form.C57H76N14O10
Mol. Mass.1117.3011
SMILESCCCC[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1cnc[nH]1)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](N)Cc1ccccc1)C(C)C)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: