Reaction Details |
| Report a problem with these data |
Target | Serotonin N-acetyltransferase |
---|
Ligand | BDBM85590 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | AANAT Assay |
---|
pH | 6.8±0 |
---|
Temperature | 310.15±0 K |
---|
IC50 | 3.9e+2± 1.6e+2 nM |
---|
Citation | Beaurain, N; Mésangeau, C; Chavatte, P; Ferry, G; Audinot, V; Boutin, JA; Delagrange, P; Bennejean, C; Yous, S Design, synthesis and in vitro evaluation of novel derivatives as serotonin N-acetyltransferase inhibitors. J Enzyme Inhib Med Chem17:409-14 (2002) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Serotonin N-acetyltransferase |
---|
Name: | Serotonin N-acetyltransferase |
Synonyms: | AANAT | Aralkylamine N-acetyltransferase | SNAT | SNAT_HUMAN | Serotonin N-acetyltransferase (AANAT) |
Type: | Protein |
Mol. Mass.: | 23350.36 |
Organism: | Homo sapiens (Human) |
Description: | Q16613 |
Residue: | 207 |
Sequence: | MSTQSTHPLKPEAPRLPPGIPESPSCQRRHTLPASEFRCLTPEDAVSAFEIEREAFISVL
GVCPLYLDEIRHFLTLCPELSLGWFEEGCLVAFIIGSLWDKERLMQESLTLHRSGGHIAH
LHVLAVHRAFRQQGRGPILLWRYLHHLGSQPAVRRAALMCEDALVPFYERFSFHAVGPCA
ITVGSLTFMELHCSLRGHPFLRRNSGC
|
|
|
BDBM85590 |
---|
n/a |
---|
Name | BDBM85590 |
Synonyms: | AANAT Inhibitor, 8h |
Type | Small organic molecule |
Emp. Form. | C12H11BrFNOS |
Mol. Mass. | 316.189 |
SMILES | Fc1ccc2scc(CCNC(=O)CBr)c2c1 |
Structure |
|