Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 4 (5-HT4)
LigandBDBM82505
Substrate/Competitorn/a
Ki 0.03±n/a nM
CommentsPDSP_1672
Citation Bender EPindon Avan Oers IZhang YBGommeren WVerhasselt PJurzak MLeysen JLuyten W Structure of the human serotonin 5-HT4 receptor gene and cloning of a novel 5-HT4 splice variant. J Neurochem 74:478-89 (2000) [PubMed]  Article
More Info.:Get all data from this article
 
5-hydroxytryptamine receptor 4 (5-HT4)
Name:Serotonin (5-HT) receptor
Synonyms:5-HT-4 | 5-HT4 | 5-HT4S | 5-HT4a | 5-HT4b | 5-HT4c | 5-HT4d | 5-HT4hb | 5-hydroxytryptamine receptor 4 | HTR4 | Serotonin (5-HT) receptor | Serotonin (5-HT3) receptor | Serotonin 4 (5-HT4) receptor | Serotonin Receptor 4
Type:Enzyme
Mol. Mass.:43767.54
Organism:Homo sapiens (Human)
Description:Q13639
Residue:388
Sequence:
MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIV
SLAFADLLVSVLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYY
AICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSN
STYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRP
QSADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQVWTAFLWL
GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRD
AVECGGQWESQCHPPATSPLVAAQPSDT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82505
n/a
NameBDBM82505
Synonyms:CAS_121881 | NSC_121881 | SB204070
TypeSmall organic molecule
Emp. Form.C19H27ClN2O4
Mol. Mass.382.882
SMILESCCCCN1CCC(COC(=O)c2cc(Cl)c(N)c3OCCOc23)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: