Reaction Details |
| Report a problem with these data |
Target | ATP receptor |
---|
Ligand | BDBM85682 |
---|
Substrate/Competitor | n/a |
---|
Ki | 1620±n/a nM |
---|
Comments | PDSP_3351 |
---|
Citation | Rettinger, J; Schmalzing, G; Damer, S; Müller, G; Nickel, P; Lambrecht, G The suramin analogue NF279 is a novel and potent antagonist selective for the P2X(1) receptor. Neuropharmacology39:2044-53 (2000) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
ATP receptor |
---|
Name: | ATP receptor |
Synonyms: | Purinergic, P2X3 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 9131.97 |
Organism: | Xenopus |
Description: | Purinergic, P2X3 0 Xenopus::Q64F95. |
Residue: | 82 |
Sequence: | TCRFHPDKAPFCPILRVGDVVKFAGQDFAKLARTGGVLGIKIGWVCDLDRAWDQCIPKYS
FTRLDGVSEKSSVSPGYNFRFA
|
|
|
BDBM85682 |
---|
n/a |
---|
Name | BDBM85682 |
Synonyms: | CAS_5311315 | NF279 | NSC_5311315 |
Type | Small organic molecule |
Emp. Form. | C49H30N6O23S6 |
Mol. Mass. | 1263.182 |
SMILES | [O-]S(=O)(=O)c1cc(c2c(NC(=O)c3ccc(NC(=O)c4ccc(NC(=O)Nc5ccc(cc5)C(=O)Nc5ccc(cc5)C(=O)Nc5ccc(c6cc(cc(c56)S([O-])(=O)=O)S([O-])(=O)=O)S([O-])(=O)=O)cc4)cc3)ccc(c2c1)S([O-])(=O)=O)S([O-])(=O)=O |
Structure |
|