Reaction Details |
| Report a problem with these data |
Target | Leukotriene B4 receptor 2 |
---|
Ligand | BDBM85695 |
---|
Substrate/Competitor | n/a |
---|
Ki | 1000±n/a nM |
---|
Comments | PDSP_923 |
---|
Citation | Wang, S; Gustafson, E; Pang, L; Qiao, X; Behan, J; Maguire, M; Bayne, M; Laz, T A novel hepatointestinal leukotriene B4 receptor. Cloning and functional characterization. J Biol Chem275:40686-94 (2000) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
Leukotriene B4 receptor 2 |
---|
Name: | Leukotriene B4 receptor 2 |
Synonyms: | BLT2R | BLTR2 | LT4R2_HUMAN | LTB4 receptor JULF2 | LTB4-R 2 | LTB4-R2 | LTB4R2 | LTB4R2 protein | Leukotriene B4 | Leukotriene B4 R2 | Leukotriene B4 receptor | Leukotriene B4 receptor 2 | Leukotriene B4 receptor BLT2 | Leukotriene b1 | Seven transmembrane receptor BLTR2 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 37964.86 |
Organism: | Homo sapiens (Human) |
Description: | Leukotriene 2 0 HUMAN::Q9NPC1 |
Residue: | 358 |
Sequence: | MSVCYRPPGNETLLSWKTSRATGTAFLLLAALLGLPGNGFVVWSLAGWRPARGRPLAATL
VLHLALADGAVLLLTPLFVAFLTRQAWPLGQAGCKAVYYVCALSMYASVLLTGLLSLQRC
LAVTRPFLAPRLRSPALARRLLLAVWLAALLLAVPAAVYRHLWRDRVCQLCHPSPVHAAA
HLSLETLTAFVLPFGLMLGCYSVTLARLRGARWGSGRHGARVGRLVSAIVLAFGLLWAPY
HAVNLLQAVAALAPPEGALAKLGGAGQAARAGTTALAFFSSSVNPVLYVFTAGDLLPRAG
PRFLTRLFEGSGEARGGGRSREGTMELRTTPQLKVVGQGRGNGDPGGGMEKDGPEWDL
|
|
|
BDBM85695 |
---|
n/a |
---|
Name | BDBM85695 |
Synonyms: | CAS_5283157 | HETE-20 | NSC_5283157 |
Type | Small organic molecule |
Emp. Form. | C20H32O3 |
Mol. Mass. | 320.4663 |
SMILES | OCCCCCC=CCC=CCC=CCC=CCCCC(O)=O |w:6.5,9.8,12.11,15.14| |
Structure |
|