Reaction Details |
| Report a problem with these data |
Target | Calcitonin gene-related peptide 1 |
---|
Ligand | BDBM50094703 |
---|
Substrate/Competitor | n/a |
---|
Ki | >10000±n/a nM |
---|
Comments | PDSP_2986 |
---|
Citation | Jarvis, MF; Yu, H; Kohlhaas, K; Alexander, K; Lee, CH; Jiang, M; Bhagwat, SS; Williams, M; Kowaluk, EA ABT-702 (4-amino-5-(3-bromophenyl)-7-(6-morpholinopyridin-3-yl)pyrido[2, 3-d]pyrimidine), a novel orally effective adenosine kinase inhibitor with analgesic and anti-inflammatory properties: I. In vitro characterization and acute antinociceptive effects in the mouse. J Pharmacol Exp Ther295:1156-64 (2000) [PubMed] |
---|
More Info.: | Get all data from this article |
---|
|
Calcitonin gene-related peptide 1 |
---|
Name: | Calcitonin gene-related peptide 1 |
Synonyms: | CALCA_RAT | CGRP | Calc | Calca | Calcitonin gene-related peptide 1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 13950.43 |
Organism: | RAT |
Description: | CGRP 0 RAT::P01256 |
Residue: | 128 |
Sequence: | MGFLKFSPFLVVSILLLYQACGLQAVPLRSTLESSPGMAATLSEEEARLLLAALVQNYMQ
MKVRELEQEQEAEGSSVTAQKRSCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAFG
RRRRDLQA
|
|
|
BDBM50094703 |
---|
n/a |
---|
Name | BDBM50094703 |
Synonyms: | 5-(3-Bromo-phenyl)-7-(6-morpholin-4-yl-pyridin-3-yl)-pyrido[2,3-d]pyrimidin-4-ylamine | 5-(3-bromophenyl)-7-(6-morpholin-4-ylpyridin-3-yl)pyrido[2,3-d]pyrimidin-4-ylamine | ABT-702 | CHEMBL66089 |
Type | Small organic molecule |
Emp. Form. | C22H19BrN6O |
Mol. Mass. | 463.33 |
SMILES | Nc1ncnc2nc(cc(-c3cccc(Br)c3)c12)-c1ccc(nc1)N1CCOCC1 |
Structure |
|