| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Interleukin-1 alpha |
|---|
| Ligand | BDBM50094703 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | >10000±n/a nM |
|---|
| Comments | PDSP_2986 |
|---|
| Citation |  Jarvis, MF; Yu, H; Kohlhaas, K; Alexander, K; Lee, CH; Jiang, M; Bhagwat, SS; Williams, M; Kowaluk, EA ABT-702 (4-amino-5-(3-bromophenyl)-7-(6-morpholinopyridin-3-yl)pyrido[2, 3-d]pyrimidine), a novel orally effective adenosine kinase inhibitor with analgesic and anti-inflammatory properties: I. In vitro characterization and acute antinociceptive effects in the mouse. J Pharmacol Exp Ther295:1156-64 (2000) [PubMed] |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Interleukin-1 alpha |
|---|
| Name: | Interleukin-1 alpha |
|---|
| Synonyms: | IL1A_RAT | Il1a | Interleukin 1-Alpha | Interleukin-1 alpha |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 30851.45 |
|---|
| Organism: | RAT |
|---|
| Description: | Interleukin 1-Alpha 0 RAT::P16598 |
|---|
| Residue: | 270 |
|---|
| Sequence: | MAKVPDLFEDLKNCYSENEEYSSAIDHLSLNQKSFYDASYGSLHENCTDKFVSLRTSETS
KMSTFTFKESRVVVSATSNKGKILKKRRLSFNQPFTEDDLEAIAHDLEETIQPRSAPHSF
QNNLRYKLIRIVKQEFIMNDSLNQNIYVDMDRIHLKAASLNDLQLEVKFDMYAYSSGGDD
SKYPVTLKVSNTQLFVSAQGEDKPVLLKEIPETPKLITGSETDLIFFWEKINSKNYFTSA
AFPELLIATKEQSQVHLARGLPSMIDFQIS
|
|
|
|---|
| BDBM50094703 |
|---|
| n/a |
|---|
| Name | BDBM50094703 |
|---|
| Synonyms: | 5-(3-Bromo-phenyl)-7-(6-morpholin-4-yl-pyridin-3-yl)-pyrido[2,3-d]pyrimidin-4-ylamine | 5-(3-bromophenyl)-7-(6-morpholin-4-ylpyridin-3-yl)pyrido[2,3-d]pyrimidin-4-ylamine | ABT-702 | CHEMBL66089 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H19BrN6O |
|---|
| Mol. Mass. | 463.33 |
|---|
| SMILES | Nc1ncnc2nc(cc(-c3cccc(Br)c3)c12)-c1ccc(nc1)N1CCOCC1 |
|---|
| Structure | 
|
|---|
Search and Browse
