Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetP2X purinoceptor 3
LigandBDBM85730
Substrate/Competitorn/a
Ki 1000±n/a nM
CommentsPDSP_3350
Citation Lambrecht G Agonists and antagonists acting at P2X receptors: selectivity profiles and functional implications. Naunyn Schmiedebergs Arch Pharmacol 362:340-50 (2000) [PubMed]  Article
More Info.:Get all data from this article
 
P2X purinoceptor 3
Name:P2X purinoceptor 3
Synonyms:ATP receptor | P2X3 | P2rx3 | Purinergic receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:44397.63
Organism:RAT
Description:Purinergic, P2X3 0 RAT::P49654
Residue:397
Sequence:
MNCISDFFTYETTKSVVVKSWTIGIINRAVQLLIISYFVGWVFLHEKAYQVRDTAIESSV
VTKVKGFGRYANRVMDVSDYVTPPQGTSVFVIITKMIVTENQMQGFCPENEEKYRCVSDS
QCGPERFPGGGILTGRCVNYSSVLRTCEIQGWCPTEVDTVEMPIMMEAENFTIFIKNSIR
FPLFNFEKGNLLPNLTDKDIKRCRFHPEKAPFCPILRVGDVVKFAGQDFAKLARTGGVLG
IKIGWVCDLDKAWDQCIPKYSFTRLDGVSEKSSVSPGYNFRFAKYYKMENGSEYRTLLKA
FGIRFDVLVYGNAGKFNIIPTIISSVAAFTSVGVGTVLCDIILLNFLKGADHYKARKFEE
VTETTLKGTASTNPVFASDQATVEKQSTDSGAYSIGH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM85730
n/a
NameBDBM85730
Synonyms:CAS_5311313 | NF023 | NSC_5311313
TypeSmall organic molecule
Emp. Form.C33H20N4O19S6
Mol. Mass.968.921
SMILES[O-]S(=O)(=O)c1cc(c2c(Nc3cccc(NC(=O)Nc4cccc(Nc5ccc(c6cc(cc(c56)S([O-])(=O)=O)S([O-])(=O)=O)S([O-])(=O)=O)c4)c3)ccc(c2c1)S([O-])(=O)=O)S([O-])(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: