| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Histamine H4 receptor |
|---|
| Ligand | BDBM35938 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 2910±n/a nM |
|---|
| Comments | PDSP_512 |
|---|
| Citation |  Nguyen, T; Shapiro, DA; George, SR; Setola, V; Lee, DK; Cheng, R; Rauser, L; Lee, SP; Lynch, KR; Roth, BL; O'Dowd, BF Discovery of a novel member of the histamine receptor family. Mol Pharmacol59:427-33 (2001) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Histamine H4 receptor |
|---|
| Name: | Histamine H4 receptor |
|---|
| Synonyms: | AXOR35 | G-protein coupled receptor 105 | GPCR105 | GPRv53 | HH4R | HISTAMINE H4 | HRH4 | HRH4_HUMAN | Histamine H4 receptor | Histamine H4 receptor (H4R) | Histamine receptor (H3 and H4) | Pfi-013 | SP9144 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 44517.02 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Binding assays were using CHO cells stably expressing hH4R receptors. |
|---|
| Residue: | 390 |
|---|
| Sequence: | MPDTNSTINLSLSTRVTLAFFMSLVAFAIMLGNALVILAFVVDKNLRHRSSYFFLNLAIS
DFFVGVISIPLYIPHTLFEWDFGKEICVFWLTTDYLLCTASVYNIVLISYDRYLSVSNAV
SYRTQHTGVLKIVTLMVAVWVLAFLVNGPMILVSESWKDEGSECEPGFFSEWYILAITSF
LEFVIPVILVAYFNMNIYWSLWKRDHLSRCQSHPGLTAVSSNICGHSFRGRLSSRRSLSA
STEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFSQSDSVALHQREHVELLRARR
LAKSLAILLGVFAVCWAPYSLFTIVLSFYSSATGPKSVWYRIAFWLQWFNSFVNPLLYPL
CHKRFQKAFLKIFCIKKQPLPSQHSRSVSS
|
|
|
|---|
| BDBM35938 |
|---|
| n/a |
|---|
| Name | BDBM35938 |
|---|
| Synonyms: | 1-(p-chlorophenyl)-1-(2-pyridyl)-3-N,N-dimethylpropylamine | 1-(p-chlorophenyl)-1-(2-pyridyl)-3-dimethylaminopropane | 3-(p-chlorophenyl)-3-(2-pyridyl)-N,N-dimethylpropylamine | 5-HT,N-ACETYL | CHEMBL505 | CHLORPHENIRAMINE | CHLORPHENIRAMINE MALEATE | Polaramin | Polaramine | Polaronil | [3H]Chlorphenamine | [3H]Chlorpheniramine | chlorophenylpyridamine | chlorphenamine | clorfeniramina | d-Chlorpheniramine | gamma-(4-chlorophenyl)-N,N-dimethyl-2-pyridinepropanamine | gamma-(4-chlorophenyl)-gamma-(2-pyridyl)propyldimethylamine |
|---|
| Type | radiolabeled ligand |
|---|
| Emp. Form. | C16H19ClN2 |
|---|
| Mol. Mass. | 274.788 |
|---|
| SMILES | CN(C)CCC(c1ccc(Cl)cc1)c1ccccn1 |
|---|
| Structure | 
|
|---|
Search and Browse
