| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Substance-K receptor |
|---|
| Ligand | BDBM85845 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 2332±n/a nM |
|---|
| Comments | PDSP_2451 |
|---|
| Citation |  Hay, DW; Giardina, GA; Griswold, DE; Underwood, DC; Kotzer, CJ; Bush, B; Potts, W; Sandhu, P; Lundberg, D; Foley, JJ; Schmidt, DB; Martin, LD; Kilian, D; Legos, JJ; Barone, FC; Luttmann, MA; Grugni, M; Raveglia, LF; Sarau, HM Nonpeptide tachykinin receptor antagonists. III. SB 235375, a low central nervous system-penetrant, potent and selective neurokinin-3 receptor antagonist, inhibits citric acid-induced cough and airways hyper-reactivity in guinea pigs. J Pharmacol Exp Ther300:314-23 (2002) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Substance-K receptor |
|---|
| Name: | Substance-K receptor |
|---|
| Synonyms: | NK-2 receptor | NK-2R | NK2R_RAT | Neurokinin 2 receptor | Neurokinin A receptor | Neurokinin NK2 | SKR | Substance-K receptor | Tac2r | Tachykinin receptor 2 | Tacr2 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 43868.63 |
|---|
| Organism: | Rattus norvegicus (Rat) |
|---|
| Description: | Neurokinin NK2 TACR2 Murine::P16610 |
|---|
| Residue: | 390 |
|---|
| Sequence: | MGTRAIVSDANILSGLESNATGVTAFSMPGWQLALWATAYLALVLVAVTGNATVIWIILA
HERMRTVTNYFIINLALADLCMAAFNATFNFIYASHNIWYFGRAFCYFQNLFPITAMFVS
IYSMTAIAADRYMAIVHPFQPRLSAPSTKAIIAGIWLVALALASPQCFYSTITVDEGATK
CVVAWPNDNGGKMLLLYHLVVFVLIYFLPLLVMFGAYSVIGLTLWKRAVPRHQAHGANLR
HLQAKKKFVKAMVLVVLTFAICWLPYHLYFILGTFQEDIYYHKFIQQVYLALFWLAMSST
MYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTEEDRLELTHTPSLSRRVNRCHTKETLFMT
GDMTHSEATNGQVGSPQDGEPAGPICKAQA
|
|
|
|---|
| BDBM85845 |
|---|
| n/a |
|---|
| Name | BDBM85845 |
|---|
| Synonyms: | N-[(S)-1-Phenylpropyl]-2-phenyl-3-(carboxymethoxy)quinoline-4-carboxamide | SB 235375 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H24N2O4 |
|---|
| Mol. Mass. | 440.4905 |
|---|
| SMILES | CC[C@H](NC(=O)c1c(OCC(O)=O)c(nc2ccccc12)-c1ccccc1)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
