Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNPFF
LigandBDBM50015490
Substrate/Competitorn/a
Ki 920±n/a nM
CommentsPDSP_1370
Citation Engström MBrandt AWurster SSavola JMPanula P Prolactin releasing peptide has high affinity and efficacy at neuropeptide FF2 receptors. J Pharmacol Exp Ther 305:825-32 (2003) [PubMed]  Article
More Info.:Get all data from this article
 
NPFF
Name:NPFF
Synonyms:FMRFamide-related peptides
Type:Enzyme Catalytic Domain
Mol. Mass.:13156.33
Organism:RAT
Description:NPFF 0 RAT::Q9WVA9
Residue:114
Sequence:
MDSKWAAVLLLLLLLRNWGHAEEAGSWGEDQVFAEEDKGPHPSQYAHTPDRIQTPGSLMR
VLLQAMERPRRNPAFLFQPQRFGRNAWGPWSKEQLSPQAREFWSLAAPQRFGKK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50015490
n/a
NameBDBM50015490
Synonyms:CHEMBL438945 | H-YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 | NPY | NPY, human | NPY, human, rat | Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro- Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His- Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 (NPY) | human Neuropeptide Y
TypeSmall organic molecule
Emp. Form.n/a
Mol. Mass.n/a
SMILESn/a
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: