| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Ionotropic glutamate receptor subunit Delta2 |
|---|
| Ligand | BDBM50062599 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 1000±n/a nM |
|---|
| Comments | PDSP_3005 |
|---|
| Citation |  Williams, K; Dattilo, M; Sabado, TN; Kashiwagi, K; Igarashi, K Pharmacology of delta2 glutamate receptors: effects of pentamidine and protons. J Pharmacol Exp Ther305:740-8 (2003) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Ionotropic glutamate receptor subunit Delta2 |
|---|
| Name: | Ionotropic glutamate receptor subunit Delta2 |
|---|
| Synonyms: | Glutamate delta 2 | Glutamate receptor delta-2 subunit |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 19076.25 |
|---|
| Organism: | Xenopus |
|---|
| Description: | B9V8R6 |
|---|
| Residue: | 168 |
|---|
| Sequence: | FDLSLWACIAGTVLLVGLLVYLLNWLNPPRLQMGSMTSTTLYNSMWFVYGSFVQQGGEVP
YTTLATRMMMGAWWLFALIVISSYTANLAAFLTISRIESSIQSLQDLSRQTDIPYGTVFD
SAVYEHVRVKGMNPFERDSMYSQMWRMINRSNGSENNVQESLEGIQKV
|
|
|
|---|
| BDBM50062599 |
|---|
| n/a |
|---|
| Name | BDBM50062599 |
|---|
| Synonyms: | 3,5-Dimethyl-adamantan-1-ylamine | CHEMBL807 | EN300-123026 | MEMANTINE | Namenda | US10214478, Compound memantine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C12H21N |
|---|
| Mol. Mass. | 179.3018 |
|---|
| SMILES | CC12CC3CC(C)(C1)CC(N)(C3)C2 |TLB:7:1:4.5.8:11,10:9:4:2.7.1,0:1:4:8.9.11,THB:7:5:11:2.1.12,12:1:4:8.9.11,12:9:4:2.7.1,6:5:11:2.1.12| |
|---|
| Structure | 
|
|---|
Search and Browse
