| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Ionotropic glutamate receptor subunit Delta2 |
|---|
| Ligand | BDBM86153 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 1000±n/a nM |
|---|
| Comments | PDSP_3006 |
|---|
| Citation |  Williams, K; Dattilo, M; Sabado, TN; Kashiwagi, K; Igarashi, K Pharmacology of delta2 glutamate receptors: effects of pentamidine and protons. J Pharmacol Exp Ther305:740-8 (2003) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Ionotropic glutamate receptor subunit Delta2 |
|---|
| Name: | Ionotropic glutamate receptor subunit Delta2 |
|---|
| Synonyms: | Glutamate delta 2 | Glutamate receptor delta-2 subunit |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 19076.25 |
|---|
| Organism: | Xenopus |
|---|
| Description: | B9V8R6 |
|---|
| Residue: | 168 |
|---|
| Sequence: | FDLSLWACIAGTVLLVGLLVYLLNWLNPPRLQMGSMTSTTLYNSMWFVYGSFVQQGGEVP
YTTLATRMMMGAWWLFALIVISSYTANLAAFLTISRIESSIQSLQDLSRQTDIPYGTVFD
SAVYEHVRVKGMNPFERDSMYSQMWRMINRSNGSENNVQESLEGIQKV
|
|
|
|---|
| BDBM86153 |
|---|
| n/a |
|---|
| Name | BDBM86153 |
|---|
| Synonyms: | CAS_180081 | MK-801 | NSC_180081 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H15N |
|---|
| Mol. Mass. | 221.297 |
|---|
| SMILES | CC12NC(Cc3ccccc13)c1ccccc21 |TLB:9:10:2:11.16,6:5:2:11.16,THB:12:11:10.5.4:2,15:16:10.5.4:2| |
|---|
| Structure | 
|
|---|
Search and Browse
