Reaction Details |
| Report a problem with these data |
Target | Pro-thyrotropin-releasing hormone-B |
---|
Ligand | BDBM86215 |
---|
Substrate/Competitor | n/a |
---|
Ki | >10000±n/a nM |
---|
Comments | PDSP_3210 |
---|
Citation | Lu, X; Bidaud, I; Ladram, A; Gershengorn, MC Pharmacological studies of thyrotropin-releasing hormone (TRH) receptors from Xenopus laevis: is xTRHR3 a TRH receptor? Endocrinology144:1842-6 (2003) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
Pro-thyrotropin-releasing hormone-B |
---|
Name: | Pro-thyrotropin-releasing hormone-B |
Synonyms: | TRHB_XENLA | thyrotropin-releasing hormone R2 | trh-b |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 26145.36 |
Organism: | Xenopus |
Description: | thyrotropin-releasing hormone R2 0 Xenopus::Q00643 |
Residue: | 224 |
Sequence: | MMFLWWLLLLGTAISHKVHSQEQPLLEEDTAPADNLDVLEKAKGILIRSFLEGFQEGQQI
NRDLPDAMEMIYKRQHPGKRFQEEIEKRQHPGKRDLEDLQLSKRQHPGRRYLEDMEKRQH
PGKREEGDWSRGYLTDDSGYLDLFSDVSKRQHPGKRVPDPFFIKRQHPGKRGIEEEDDTE
FENSKEVGKRQHPGKRYDPCEGPNAYNCNSGNLQLDSVEEGWAA
|
|
|
BDBM86215 |
---|
n/a |
---|
Name | BDBM86215 |
Synonyms: | Pyr3TRH |
Type | Small organic molecule |
Emp. Form. | C17H23N5O4 |
Mol. Mass. | 361.3956 |
SMILES | NC(=O)C1CCCN1C(=O)C(Cc1cnc[nH]1)NC(=O)[C@@H]1CCC(=O)C1 |
Structure |
|