| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Interleukin-8 |
|---|
| Ligand | BDBM277702 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | PBMC Cell Assay |
|---|
| IC50 | 7.30±n/a nM |
|---|
| Citation |  Fyfe, MC; Thom, SM Kinase inhibitors US Patent US10072034 Publication Date 9/11/2018 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Interleukin-8 |
|---|
| Name: | Interleukin-8 |
|---|
| Synonyms: | CXCL8 | IL8 | IL8_HUMAN | MDNCF-a | interleukin 8 precursor |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 11104.05 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_577736 |
|---|
| Residue: | 99 |
|---|
| Sequence: | MTSKLAVALLAAFLISAALCEGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPH
CANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
|
|
|
|---|
| BDBM277702 |
|---|
| n/a |
|---|
| Name | BDBM277702 |
|---|
| Synonyms: | 5-((2-(3-((4-((4-(3-(5-tert-Butyl)-2-methoxy-3-(methylsulfonamido)phenyl)ureido)-naphthalen-1-yl)oxy)pyridin-2-yl)amino)-5-methoxyphenoxy)ethoxy)methyl)thiophene-3-carboxylic acid | US10072034, Example 27 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C43H45N5O10S2 |
|---|
| Mol. Mass. | 855.975 |
|---|
| SMILES | COc1cc(Nc2cc(Oc3ccc(NC(=O)Nc4cc(cc(NS(C)(=O)=O)c4OC)C(C)(C)C)c4ccccc34)ccn2)cc(OCCOCc2cc(cs2)C(O)=O)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
