Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclooxygenase-1 (COX-1)
LigandBDBM50009859
Substrate/Competitorn/a
Ki 48±n/a nM
CommentsPDSP_3993
Citation Weir MRSperling RSReicin AGertz BJ Selective COX-2 inhibition and cardiovascular effects: a review of the rofecoxib development program. Am Heart J 146:591-604 (2003) [PubMed]  Article
More Info.:Get all data from this article
 
Cyclooxygenase-1 (COX-1)
Name:Cyclooxygenase
Synonyms:COX-1 | Cyclooxygenase-1 | Prostaglandin G/H synthase (cyclooxygenase)
Type:Enzyme
Mol. Mass.:68692.62
Organism:Homo sapiens (Human)
Description:P23219
Residue:599
Sequence:
MSRSLLLWFLLFLLLLPPLPVLLADPGAPTPVNPCCYYPCQHQGICVRFGLDRYQCDCTR
TGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWEFVNATFIREMLMRLVLTVRS
NLIPSPPTYNSAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDAQLLARRF
LLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQ
YQLRLFKDGKLKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLY
ATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQLSGYFLQLKF
DPELLFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKVGSQEYSYEQFLFNTSMLVDYGVEA
LVDAFSRQIAGRIGGGRNMDHHILHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQEL
VGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICS
PEYWKPSTFGGEVGFNIVKTATLKKLVCLNTKTCPYVSFRVPDASQDDGPAVERPSTEL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50009859
n/a
NameBDBM50009859
Synonyms:(+-)-2-(p-isobutylphenyl)propionic acid | (+-)-alpha-methyl-4-(2-methylpropyl)benzeneacetic acid | (+-)-ibuprofen | (+-)-p-isobutylhydratropic acid | (4-isobutylphenyl)-alpha-methylacetic acid | (RS)-ibuprofen | 2-(4-isobutylphenyl)propanoic acid | 2-[4-(2-methylpropyl)phenyl]propanoic acid | 4-isobutylhydratropic acid | Advil | Brufen | CHEMBL521 | IBUPROFEN LYSINE | Ibuprofen | Ibuprofen (1) | Motrin | alpha-(4-isobutylphenyl)propionic acid | alpha-(p-isobutylphenyl)propionic acid
TypeSmall organic molecule
Emp. Form.C13H18O2
Mol. Mass.206.2808
SMILESCC(C)Cc1ccc(cc1)C(C)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: