Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetP2X purinoceptor 2
LigandBDBM86483
Substrate/Competitorn/a
Ki 4.6±n/a nM
CommentsPDSP_4068
Citation Jarvis MFBianchi BUchic JTCartmell JLee CHWilliams MFaltynek C [3H]A-317491, a novel high-affinity non-nucleotide antagonist that specifically labels human P2X2/3 and P2X3 receptors. J Pharmacol Exp Ther 310:407-16 (2004) [PubMed]  Article
More Info.:Get all data from this article
 
P2X purinoceptor 2
Name:P2X purinoceptor 2
Synonyms:ATP receptor | P2RX2 | P2X2 | Purinergic receptor | PurinergicP2X2/3
Type:Enzyme Catalytic Domain
Mol. Mass.:51765.18
Organism:Homo sapiens (Human)
Description:PurinergicP2X2/3 0 HUMAN::Q9UBL9
Residue:471
Sequence:
MAAAQPKYPAGATARRLARGCWSALWDYETPKVIVVRNRRLGVLYRAVQLLILLYFVWYV
FIVQKSYQESETGPESSIITKVKGITTSEHKVWDVEEYVKPPEGGSVFSIITRVEATHSQ
TQGTCPESIRVHNATCLSDADCVAGELDMLGNGLRTGRCVPYYQGPSKTCEVFGWCPVED
GASVSQFLGTMAPNFTILIKNSIHYPKFHFSKGNIADRTDGYLKRCTFHEASDLYCPIFK
LGFIVEKAGESFTELAHKGGVIGVIINWDCDLDLPASECNPKYSFRRLDPKHVPASSGYN
FRFAKYYKINGTTTRTLIKAYGIRIDVIVHGQAGKFSLIPTIINLATALTSVGVGSFLCD
WILLTFMNKNKVYSHKKFDKVCTPSHPSGSWPVTLARVLGQAPPEPGHRSEDQHPSPPSG
QEGQQGAECGPAFPPLRPCPISAPSEQMVDTPASEPAQASTPTDPKGLAQL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM86483
n/a
NameBDBM86483
Synonyms:AP4A | CAS_175692 | NSC_175692
TypeSmall organic molecule
Emp. Form.C24H28N10O19P4
Mol. Mass.884.4298
SMILESOC1C(COP(O)(=O)OP(O)(=O)OP(O)(=O)OP(O)(=O)OCC2OC(C(O)C2O)n2cnc3c4nccn4cnc23)OC(C1O)n1cnc2c3nccn3cnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: