| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gastrin-releasing peptide |
|---|
| Ligand | BDBM86503 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 1±n/a nM |
|---|
| Comments | PDSP_3746 |
|---|
| Citation |  Mantey, SA; Coy, DH; Entsuah, LK; Jensen, RT Development of bombesin analogs with conformationally restricted amino acid substitutions with enhanced selectivity for the orphan receptor human bombesin receptor subtype 3. J Pharmacol Exp Ther310:1161-70 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Gastrin-releasing peptide |
|---|
| Name: | Gastrin-releasing peptide |
|---|
| Synonyms: | GRP | GRP_HUMAN |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 16223.81 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Gastrin-Releasing peptide 0 HUMAN::P07492 |
|---|
| Residue: | 148 |
|---|
| Sequence: | MRGRELPLVLLALVLCLAPRGRAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGESSS
VSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFK
DVGSKGKVGRLSAPGSQREGRNPQLNQQ
|
|
|
|---|
| BDBM86503 |
|---|
| n/a |
|---|
| Name | BDBM86503 |
|---|
| Synonyms: | CAS_0 | NSC_0 | [D-Tyr6,Beta-Dap11,Phe13,Nle14]Bn(6-14) |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C56H78N17O10 |
|---|
| Mol. Mass. | 1149.3259 |
|---|
| SMILES | CCCC[C@H](NC(=O)[C@H](Cc1ccccc1)N[N+](=N)[C@H](Cc1cnc[nH]1)NC(=O)C(N)CNC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](N)Cc1ccc(O)cc1)C(C)C)C(N)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
