Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCholinergic, Nicotinic Alpha6Beta3Beta4Alpha5
LigandBDBM50004656
Substrate/Competitorn/a
Ki 3250±n/a nM
CommentsPDSP_467
Citation Grinevich VPLetchworth SRLindenberger KAMenager JMary VSadieva KABuhlman LMBohme GAPradier LBenavides JLukas RJBencherif M Heterologous expression of human {alpha}6{beta}4{beta}3{alpha}5 nicotinic acetylcholine receptors: binding properties consistent with their natural expression require quaternary subunit assembly including the {alpha}5 subunit. J Pharmacol Exp Ther 312:619-26 (2005) [PubMed]  Article
More Info.:Get all data from this article
 
Cholinergic, Nicotinic Alpha6Beta3Beta4Alpha5
Name:Cholinergic, Nicotinic Alpha6Beta3Beta4Alpha5
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:51875.01
Organism:RAT
Description:Cholinergic, Nicotinic Alpha6Beta3Beta4Alpha5 0 RAT::P20420
Residue:452
Sequence:
MVQLLAGRWRPTGARRGTRGGLPELSSAAKHEDSLFRDLFEDYERWVRPVEHLSDKIKIK
FGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKIIRVPSDSLWIPDIVL
FDNADGRFEGASTKTVVRYNGTVTWTQPANYKSSCTIDVTFFPFDLQNCSMKFGSWTYDG
SQVDIILEDQDVDRTDFFDNGEWEIMSAMGSKGNRTDSCCWYPYITYSFVIKRLPLFYTL
FLIIPCIGLSFLTVVVFYLPSNEGEKISLCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGE
YLVFTMIFVTLSIMVTVFAINIHHRSSSTHNAMAPWVRKIFLHKLPKLLCMRSHADRYFT
QREEAESGAGPKSRNTLEAALDCIRYITRHVVKENDVREVVEDWKFIAQVLDRMFLWTFL
LVSIIGTLGLFVPVIYKWANIIVPVHIGNTIK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50004656
n/a
NameBDBM50004656
Synonyms:(2-Carbamoyloxy-ethyl)-trimethyl-ammonium | (2-Carbamoyloxyethyl)trimethylammonium chloride | (2-Hydroxyethyl)trimethyl ammonium chloride carbamate | (2-Hydroxyethyl)trimethylammonium chloride carbamate | (carbachol)(2-Carbamoyloxy-ethyl)-trimethyl-ammonium | 2-((Aminocarbonyl)oxy)-N,N,N-trimethylethanaminium chloride | 2-((Aminocarbonyl)oxy)-N,N,N-trimethylethanaminum chloride | 2-(carbamoyloxy)-N,N,N-trimethylethanaminium | 2-(carbamoyloxy)-N,N,N-trimethylethanaminium chloride | CARBACHOL | CARBASTAT | CHEMBL14 | Carbachol chloride | Carbamylcholine | Choline carbamate chloride | Choline chloride, carbamate | Choline chlorine carbamate | Karbachol | Karbamoylcholin chlorid | MIOSTAT
TypeSmall organic molecule
Emp. Form.C6H15N2O2
Mol. Mass.147.195
SMILESC[N+](C)(C)CCOC(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: