Reaction Details |
| Report a problem with these data |
Target | 5-hydroxytryptamine 1D receptor |
---|
Ligand | BDBM86757 |
---|
Substrate/Competitor | n/a |
---|
Ki | 88.3±n/a nM |
---|
Comments | PDSP_7627 |
---|
Citation | Kumar, JS; Prabhakaran, J; Majo, VJ; Milak, MS; Hsiung, SC; Tamir, H; Simpson, NR; Van Heertum, RL; Mann, JJ; Parsey, RV Synthesis and in vivo evaluation of a novel 5-HT1A receptor agonist radioligand [O-methyl- 11C]2-(4-(4-(2-methoxyphenyl)piperazin-1-yl)butyl)-4-methyl-1,2,4-triazine-3,5(2H,4H)dione in nonhuman primates. Eur J Nucl Med Mol Imaging34:1050-60 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
5-hydroxytryptamine 1D receptor |
---|
Name: | 5-hydroxytryptamine 1D receptor |
Synonyms: | 5-hydroxytryptamine 1D receptor (5HT1D) | HTR1D |
Type: | Protein |
Mol. Mass.: | 12731.52 |
Organism: | Bos taurus (Bovine) |
Description: | Q8MI13 |
Residue: | 119 |
Sequence: | SNRSLNATATQGAWDPGTLQALKIALVVLLSIITLATVLSNAFVLTTIFLTRKLHTPANC
LIGSLAMTDLLVSILVMPISIAYTTTHTWSFGQLLCDIWLSSDITCCTASILHLCVIAL
|
|
|
BDBM86757 |
---|
n/a |
---|
Name | BDBM86757 |
Synonyms: | CAS_0 | NSC_11603174 | [11C]MMP |
Type | Small organic molecule |
Emp. Form. | C19H27N5O3 |
Mol. Mass. | 373.4494 |
SMILES | COc1ccccc1N1CCN(CCCCn2ncc(=O)n(C)c2=O)CC1 |
Structure |
|