| Reaction Details |
|---|
 | Report a problem with these data |
| Target | AP-2 complex subunit sigma |
|---|
| Ligand | BDBM81790 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | >10000±n/a nM |
|---|
| Comments | PDSP_287 |
|---|
| Citation |  Abbas, AI; Hedlund, PB; Huang, XP; Tran, TB; Meltzer, HY; Roth, BL Amisulpride is a potent 5-HT7 antagonist: relevance for antidepressant actions in vivo. Psychopharmacology (Berl)205:119-28 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| AP-2 complex subunit sigma |
|---|
| Name: | AP-2 complex subunit sigma |
|---|
| Synonyms: | AP-2 complex subunit sigma | AP2S1_RAT | Ap17 | Ap2s1 | Claps2 | Sigma-2 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 17016.49 |
|---|
| Organism: | RAT |
|---|
| Description: | Sigma-2 0 RAT::P62744 |
|---|
| Residue: | 142 |
|---|
| Sequence: | MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYR
RYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLA
GEIRETSQTKVLKQLLMLQSLE
|
|
|
|---|
| BDBM81790 |
|---|
| n/a |
|---|
| Name | BDBM81790 |
|---|
| Synonyms: | Amisulpride | CAS_71675-85-9 | NSC_2159 | US10167256, Amisulpride | US10259786, Amisulpride |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H27N3O4S |
|---|
| Mol. Mass. | 369.479 |
|---|
| SMILES | CCN1CCCC1CNC(=O)c1cc(c(N)cc1OC)S(=O)(=O)CC |
|---|
| Structure | 
|
|---|
Search and Browse
