| Reaction Details |
|---|
 | Report a problem with these data |
| Target | V-type proton ATPase subunit c' |
|---|
| Ligand | BDBM87567 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Dose Response of Small Molecules that Regulate V-ATPase Proton Transport in Yeast using pHLuorin, Cherry Pick 2 |
|---|
| EC50 | 3644±n/a nM |
|---|
| Citation |  PubChem, PC Dose Response of Small Molecules that Regulate V-ATPase Proton Transport in Yeast using pHLuorin, Cherry Pick 2 PubChem Bioassay(2012)[AID] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| V-type proton ATPase subunit c' |
|---|
| Name: | V-type proton ATPase subunit c' |
|---|
| Synonyms: | CLS9 | TFP3 | VATL2_YEAST | VMA11 | Vma11p |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 17039.28 |
|---|
| Organism: | Saccharomyces cerevisiae S288c |
|---|
| Description: | gi_6325022 |
|---|
| Residue: | 164 |
|---|
| Sequence: | MSTQLASNIYAPLYAPFFGFAGCAAAMVLSCLGAAIGTAKSGIGIAGIGTFKPELIMKSL
IPVVMSGILAIYGLVVAVLIAGNLSPTEDYTLFNGFMHLSCGLCVGFACLSSGYAIGMVG
DVGVRKYMHQPRLFVGIVLILIFSEVLGLYGMIVALILNTRGSE
|
|
|
|---|
| BDBM87567 |
|---|
| n/a |
|---|
| Name | BDBM87567 |
|---|
| Synonyms: | MLS001234266 | SMR000811639 | [4-(6-fluoranyl-1,3-benzothiazol-2-yl)piperazin-1-yl]-(5-nitrofuran-2-yl)methanone | [4-(6-fluoro-1,3-benzothiazol-2-yl)-1-piperazinyl]-(5-nitro-2-furanyl)methanone | [4-(6-fluoro-1,3-benzothiazol-2-yl)piperazin-1-yl]-(5-nitrofuran-2-yl)methanone | [4-(6-fluoro-1,3-benzothiazol-2-yl)piperazino]-(5-nitro-2-furyl)methanone | cid_7539130 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H13FN4O4S |
|---|
| Mol. Mass. | 376.362 |
|---|
| SMILES | [O-][N+](=O)c1ccc(o1)C(=O)N1CCN(CC1)c1nc2ccc(F)cc2s1 |
|---|
| Structure | 
|
|---|
Search and Browse
