Reaction Details |
| Report a problem with these data |
Target | V-type proton ATPase subunit c' |
---|
Ligand | BDBM3738 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Dose Response of Small Molecules that Regulate V-ATPase Proton Transport in Yeast using pHLuorin, Powder Set1 |
---|
EC50 | 9817±n/a nM |
---|
Citation | PubChem, PC Dose Response of Small Molecules that Regulate V-ATPase Proton Transport in Yeast using pHLuorin, Powder Set1 PubChem Bioassay(2012)[AID] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
V-type proton ATPase subunit c' |
---|
Name: | V-type proton ATPase subunit c' |
Synonyms: | CLS9 | TFP3 | VATL2_YEAST | VMA11 | Vma11p |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 17039.28 |
Organism: | Saccharomyces cerevisiae S288c |
Description: | gi_6325022 |
Residue: | 164 |
Sequence: | MSTQLASNIYAPLYAPFFGFAGCAAAMVLSCLGAAIGTAKSGIGIAGIGTFKPELIMKSL
IPVVMSGILAIYGLVVAVLIAGNLSPTEDYTLFNGFMHLSCGLCVGFACLSSGYAIGMVG
DVGVRKYMHQPRLFVGIVLILIFSEVLGLYGMIVALILNTRGSE
|
|
|
BDBM3738 |
---|
n/a |
---|
Name | BDBM3738 |
Synonyms: | cid_32250470 |
Type | n/a |
Emp. Form. | C15H13F3N4O4 |
Mol. Mass. | 370.2833 |
SMILES | [O-][N+](=O)c1ccc(o1)C(=O)N1CCN(CC1)c1ccc(cn1)C(F)(F)F |
Structure |
|