Reaction Details |
| Report a problem with these data |
Target | V-type proton ATPase subunit c' |
---|
Ligand | BDBM88691 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Dose Response with BCECF Assay for V-ATPase inhibitors that increase vacuolar pH, Powder Set 1 |
---|
EC50 | 728±n/a nM |
---|
Citation | PubChem, PC Dose Response with BCECF Assay for V-ATPase inhibitors that increase vacuolar pH, Powder Set 1 PubChem Bioassay(2012)[AID] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
V-type proton ATPase subunit c' |
---|
Name: | V-type proton ATPase subunit c' |
Synonyms: | CLS9 | TFP3 | VATL2_YEAST | VMA11 | Vma11p |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 17039.28 |
Organism: | Saccharomyces cerevisiae S288c |
Description: | gi_6325022 |
Residue: | 164 |
Sequence: | MSTQLASNIYAPLYAPFFGFAGCAAAMVLSCLGAAIGTAKSGIGIAGIGTFKPELIMKSL
IPVVMSGILAIYGLVVAVLIAGNLSPTEDYTLFNGFMHLSCGLCVGFACLSSGYAIGMVG
DVGVRKYMHQPRLFVGIVLILIFSEVLGLYGMIVALILNTRGSE
|
|
|
BDBM88691 |
---|
n/a |
---|
Name | BDBM88691 |
Synonyms: | VU0465039-1 | [4-(6-methoxy-1,3-benzothiazol-2-yl)-1-piperazinyl]-(5-nitro-2-furanyl)methanone | [4-(6-methoxy-1,3-benzothiazol-2-yl)piperazin-1-yl]-(5-nitrofuran-2-yl)methanone | [4-(6-methoxy-1,3-benzothiazol-2-yl)piperazino]-(5-nitro-2-furyl)methanone | cid_7538979 |
Type | Small organic molecule |
Emp. Form. | C17H16N4O5S |
Mol. Mass. | 388.398 |
SMILES | COc1ccc2nc(sc2c1)N1CCN(CC1)C(=O)c1ccc(o1)[N+]([O-])=O |
Structure |
|