| Reaction Details |
|---|
 | Report a problem with these data |
| Target | V-type proton ATPase subunit c' |
|---|
| Ligand | BDBM3738 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Dose Response with BCECF Assay for V-ATPase inhibitors that increase vacuolar pH, Powder Set 1 |
|---|
| EC50 | 1588±n/a nM |
|---|
| Citation |  PubChem, PC Dose Response with BCECF Assay for V-ATPase inhibitors that increase vacuolar pH, Powder Set 1 PubChem Bioassay(2012)[AID] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| V-type proton ATPase subunit c' |
|---|
| Name: | V-type proton ATPase subunit c' |
|---|
| Synonyms: | CLS9 | TFP3 | VATL2_YEAST | VMA11 | Vma11p |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 17039.28 |
|---|
| Organism: | Saccharomyces cerevisiae S288c |
|---|
| Description: | gi_6325022 |
|---|
| Residue: | 164 |
|---|
| Sequence: | MSTQLASNIYAPLYAPFFGFAGCAAAMVLSCLGAAIGTAKSGIGIAGIGTFKPELIMKSL
IPVVMSGILAIYGLVVAVLIAGNLSPTEDYTLFNGFMHLSCGLCVGFACLSSGYAIGMVG
DVGVRKYMHQPRLFVGIVLILIFSEVLGLYGMIVALILNTRGSE
|
|
|
|---|
| BDBM3738 |
|---|
| n/a |
|---|
| Name | BDBM3738 |
|---|
| Synonyms: | cid_32250470 |
|---|
| Type | n/a |
|---|
| Emp. Form. | C15H13F3N4O4 |
|---|
| Mol. Mass. | 370.2833 |
|---|
| SMILES | [O-][N+](=O)c1ccc(o1)C(=O)N1CCN(CC1)c1ccc(cn1)C(F)(F)F |
|---|
| Structure | 
|
|---|
Search and Browse
