Reaction Details |
| Report a problem with these data |
Target | Dual specificity protein phosphatase 3 |
---|
Ligand | BDBM88794 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Dose Response selectivity of inhibitors of STriatal-Enriched Phosphatase (STEP) in the dual-specificity protein-tyrosine phosphatase VHR Inhibition Assay |
---|
IC50 | 21700±n/a nM |
---|
Citation | PubChem, PC Dose Response selectivity of inhibitors of STriatal-Enriched Phosphatase (STEP) in the dual-specificity protein-tyrosine phosphatase VHR Inhibition Assay PubChem Bioassay(2012)[AID] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dual specificity protein phosphatase 3 |
---|
Name: | Dual specificity protein phosphatase 3 |
Synonyms: | DUS3_HUMAN | DUSP3 | Dual specificity protein phosphatase (VHR) | Dual specificity protein phosphatase 3 | Dual specificity protein phosphatase VHR | Protein Tyrosine Phosphatase VHR | Tyrosine-protein phosphatase non-receptor type 1 | VHR |
Type: | Hydrolase |
Mol. Mass.: | 20480.58 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 185 |
Sequence: | MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVL
NAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRV
LVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKE
GKLKP
|
|
|
BDBM88794 |
---|
n/a |
---|
Name | BDBM88794 |
Synonyms: | MLS001222829 | N-(4-Nitro-phenyl)-2-{4-[(pyridine-4-carbonyl)-hydrazonomethyl]-phenoxy}-acetamide | N-[(E)-[4-[2-(4-nitroanilino)-2-oxoethoxy]phenyl]methylideneamino]-4-pyridinecarboxamide | N-[(E)-[4-[2-(4-nitroanilino)-2-oxoethoxy]phenyl]methylideneamino]pyridine-4-carboxamide | N-[(E)-[4-[2-[(4-nitrophenyl)amino]-2-oxidanylidene-ethoxy]phenyl]methylideneamino]pyridine-4-carboxamide | N-[(E)-[4-[2-keto-2-(4-nitroanilino)ethoxy]benzylidene]amino]isonicotinamide | SMR000608052 | cid_9593322 |
Type | Small organic molecule |
Emp. Form. | C21H17N5O5 |
Mol. Mass. | 419.3902 |
SMILES | [O-][N+](=O)c1ccc(NC(=O)COc2ccc([CH+][N-]NC(=O)c3ccncc3)cc2)cc1 |
Structure |
|