BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHigh-affinity choline transporter
LigandBDBM39693
Substrate/Competitorn/a
Meas. Tech.Dose responses of compounds that activate the Choline Transporter (CHT) - 10 point CRC
EC50 11370±n/a nM
Citation PubChem PC Dose responses of compounds that activate the Choline Transporter (CHT) - 10 point CRC PubChem Bioassay (2012)[AID]
More Info.:Get all data from this article,  Assay Method
 
High-affinity choline transporter
Name:High-affinity choline transporter
Synonyms:high affinity choline transporter 1
Type:PROTEIN
Mol. Mass.:63194.33
Organism:Homo sapiens (Human)
Description:ChEMBL_1464247
Residue:580
Sequence:
MAFHVEGLIAIIVFYLLILLVGIWAAWRTKNSGSAEERSEAIIVGGRDIGLLVGGFTMTA
TWVGGGYINGTAEAVYVPGYGLAWAQAPIGYSLSLILGGLFFAKPMRSKGYVTMLDPFQQ
IYGKRMGGLLFIPALMGEMFWAAAIFSALGATISVIIDVDMHISVIISALIATLYTLVGG
LYSVAYTDVVQLFCIFVGLWISVPFALSHPAVADIGFTAVHAKYQKPWLGTVDSSEVYSW
LDSFLLLMLGGIPWQAYFQRVLSSSSATYAQVLSFLAAFGCLVMAIPAILIGAIGASTDW
NQTAYGLPDPKTTEEADMILPIVLQYLCPVYISFFGLGAVSAAVMSSADSSILSASSMFA
RNIYQLSFRQNASDKEIVWVMRITVFVFGASATAMALLTKTVYGLWYLSSDLVYIVIFPQ
LLCVLFVKGTNTYGAVAGYVSGLFLRITGGEPYLYLQPLIFYPGYYPDDNGIYNQKFPFK
TLAMVTSFLTNICISYLAKYLFESGTLPPKLDVFDAVVARHSEENMDKTILVKNENIKLD
ELALVKPRQSMTLSSTFTNKEAFLDVDSSPEGSGTEDNLQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM39693
n/a
NameBDBM39693
Synonyms:1-[2-(diethylamino)ethyl]-N-[[1-(phenylmethyl)-2-benzimidazolyl]methyl]-2-benzimidazolamine | 1-[2-(diethylamino)ethyl]-N-[[1-(phenylmethyl)benzimidazol-2-yl]methyl]benzimidazol-2-amine | 2-[2-[(1-benzylbenzimidazol-2-yl)methylamino]benzimidazol-1-yl]ethyl-diethyl-amine | MLS000533134 | N-[(1-benzyl-1H-benzimidazol-2-yl)methyl]-1-[2-(diethylamino)ethyl]-1H-benzimidazol-2-amine | N-[(1-benzylbenzimidazol-2-yl)methyl]-1-[2-(diethylamino)ethyl]benzimidazol-2-amine | SMR000140572 | cid_1253120
TypeSmall organic molecule
Emp. Form.C28H32N6
Mol. Mass.452.5939
SMILESCCN(CC)CCn1c(NCc2nc3ccccc3n2Cc2ccccc2)nc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: