Reaction Details |
| Report a problem with these data |
Target | Corticotropin-releasing factor-binding protein |
---|
Ligand | BDBM89703 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Dose Response confirmation of uHTS hits for small molecule agonists of the CRF-binding protein and CRF-R2 receptor complex |
---|
EC50 | >53000±n/a nM |
---|
Citation | PubChem, PC Dose Response confirmation of uHTS hits for small molecule agonists of the CRF-binding protein and CRF-R2 receptor complex PubChem Bioassay(2012)[AID] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Corticotropin-releasing factor-binding protein |
---|
Name: | Corticotropin-releasing factor-binding protein |
Synonyms: | CRFBP | CRHBP | CRHBP_HUMAN | corticotropin releasing factor-binding protein |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 36143.95 |
Organism: | Homo sapiens (Human) |
Description: | P24387 |
Residue: | 322 |
Sequence: | MSPNFKLQCHFILIFLTALRGESRYLELREAADYDPFLLFSANLKRELAGEQPYRRALRC
LDMLSLQGQFTFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKG
EKFPSSQDHPLPSAERYIDFCESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNL
FPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGI
GDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNTVVRMVSSGKHVNRVTFEYRQ
LEPYELENPNGNSIGEFCLSGL
|
|
|
BDBM89703 |
---|
n/a |
---|
Name | BDBM89703 |
Synonyms: | 4,5-dimethoxy-2-[(5-methyl-3-phenyl-isoxazole-4-carbonyl)amino]benzoic acid methyl ester | 4,5-dimethoxy-2-[[(5-methyl-3-phenyl-4-isoxazolyl)-oxomethyl]amino]benzoic acid methyl ester | MLS000051717 | SMR000080551 | cid_1246353 | methyl 4,5-dimethoxy-2-[(5-methyl-3-phenyl-1,2-oxazol-4-yl)carbonylamino]benzoate | methyl 4,5-dimethoxy-2-[(5-methyl-3-phenyl-1,2-oxazole-4-carbonyl)amino]benzoate | methyl 4,5-dimethoxy-2-{[(5-methyl-3-phenyl-4-isoxazolyl)carbonyl]amino}benzoate |
Type | Small organic molecule |
Emp. Form. | C21H20N2O6 |
Mol. Mass. | 396.3933 |
SMILES | COC(=O)c1cc(OC)c(OC)cc1NC(=O)c1c(C)onc1-c1ccccc1 |
Structure |
|