Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKallikrein 7
LigandBDBM113067
Substrate/Competitorn/a
Meas. Tech.KLK7 Assay
pH7.2±n/a
Temperature310.15±n/a K
Ki 116±n/a nM
Commentsextracted
Citation Wagberg FLeonardsson G Benzoxazinone derivatives for treatment of skin diseases US Patent  US9695194 Publication Date 7/4/2017
More Info.:Get all data from this article,  Assay Method
 
Kallikrein 7
Name:Kallikrein 7
Synonyms:Kallikrein-7 | Serine protease 6 | Stratum corneum chymotryptic enzyme | hK7 | hSCCE | kallikrein-7 isoform 1 preproprotein
Type:PROTEIN
Mol. Mass.:27535.05
Organism:Homo sapiens (Human)
Description:ChEMBL_1469257
Residue:253
Sequence:
MARSLLLPLQILLLSLALETAGEEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLV
NERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNS
QARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVY
KDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCK
FTKWINDTMKKHR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM113067
n/a
NameBDBM113067
Synonyms:US9695194, 3
TypeSmall organic molecule
Emp. Form.C19H19NO6
Mol. Mass.357.3573
SMILESCCOc1cc2c(cc1OC)nc(oc2=O)-c1ccc(OC)cc1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: