| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 3-oxo-5-alpha-steroid 4-dehydrogenase 2 |
|---|
| Ligand | BDBM92330 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | 5Alpha-Reductase Activity Assay |
|---|
| pH | 6.5±0 |
|---|
| Temperature | 310.15±0 K |
|---|
| IC50 | 4.9±0.0 nM |
|---|
| Citation |  Bratoeff, E; Segura, T; Recillas, S; Carrizales, E; Palacios, A; Heuze, I; Cabeza, M Aromatic esters of progesterone as 5alpha-reductase and prostate growth inhibitors. J Enzyme Inhib Med Chem24:655-62 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| 3-oxo-5-alpha-steroid 4-dehydrogenase 2 |
|---|
| Name: | 3-oxo-5-alpha-steroid 4-dehydrogenase 2 |
|---|
| Synonyms: | 3-oxo-5-alpha-steroid 4-dehydrogenase 2 | 5 alpha-SR2 | 5α-Reductase 2 (5α-R2) | S5A2_HUMAN | SR type 2 | SRD5A2 | Steroid 5-alpha-reductase | Steroid 5-alpha-reductase 2 | Type II 5-alpha reductase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 28406.59 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P31213 |
|---|
| Residue: | 254 |
|---|
| Sequence: | MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPARAAWFLQELPS
FAVPAGILARQPLSLFGPPGTVLLGLFCLHYFHRTFVYSLLNRGRPYPAILILRGTAFCT
GNGVLQGYYLIYCAEYPDGWYTDIRFSLGVFLFILGMGINIHSDYILRQLRKPGEISYRI
PQGGLFTYVSGANFLGEIIEWIGYALATWSLPALAFAFFSLCFLGLRAFHHHRFYLKMFE
DYPKSRKALIPFIF
|
|
|
|---|
| BDBM92330 |
|---|
| n/a |
|---|
| Name | BDBM92330 |
|---|
| Synonyms: | Steroid, 10b |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H33BrO5 |
|---|
| Mol. Mass. | 529.463 |
|---|
| SMILES | CC(=O)[C@]1(CCC2C3CC[C@@]45O[C@@H]4C(=O)CC[C@]5(C)C3CC[C@]12C)OC(=O)c1ccc(Br)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
