| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Acid phosphatase |
|---|
| Ligand | BDBM50090256 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Inhibitor Screening Assay |
|---|
| Ki | 3.80e+5± 1.60e+5 nM |
|---|
| Citation |  McRae, S; Pagliai, FA; Mohapatra, NP; Gener, A; Mahmou, AS; Gunn, JS; Lorca, GL; Gonzalez, CF Inhibition of AcpA phosphatase activity with ascorbate attenuates Francisella tularensis intramacrophage survival. J Biol Chem285:5171-7 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Acid phosphatase |
|---|
| Name: | Acid phosphatase |
|---|
| Synonyms: | Acid phosphatase (acpA) | Acid phosphatase (acpB) | Acid phosphatase (acpC) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 22350.38 |
|---|
| Organism: | Francisella tularensis |
|---|
| Description: | Q5NIC0 |
|---|
| Residue: | 194 |
|---|
| Sequence: | MTQQQVISYYESTAHENEVELILARAKKIIQAQQSLQGNAIVLDIDETALNHYYSLKLAG
FPQGENHTIWNELLSRTDAYPIKATLDFYLYCLTSGLKVFFISARFAQYLESTKQALRNA
GYVNFEDVFVFPENIEQYNSKDFKNFKAERRAYIESLGYKILISIGDQSSDLLGGYTLYT
LQLPNYLYGENSRF
|
|
|
|---|
| BDBM50090256 |
|---|
| n/a |
|---|
| Name | BDBM50090256 |
|---|
| Synonyms: | (R)-2-((S)-1,2-dihydroxyethyl)-4,5-dihydroxyfuran-3(2H)-one | (R)-5-((S)-1,2-Dihydroxy-ethyl)-3,4-dihydroxy-5H-furan-2-one | (R)-5-((S)-1,2-dihydroxyethyl)-3,4-dihydroxyfuran-2(5H)-one | 5-(1,2-Dihydroxy-ethyl)-3,4-dihydroxy-5H-furan-2-one(AsA) | CHEMBL196 | ascorbic acid | vitamin C |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C6H8O6 |
|---|
| Mol. Mass. | 176.1241 |
|---|
| SMILES | OC[C@H](O)c1oc(O)c(O)c1O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
