| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Acid phosphatase |
|---|
| Ligand | BDBM92476 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Inhibitor Screening Assay |
|---|
| Ki | 3.27e+3± 8.5e+2 nM |
|---|
| Citation |  McRae, S; Pagliai, FA; Mohapatra, NP; Gener, A; Mahmou, AS; Gunn, JS; Lorca, GL; Gonzalez, CF Inhibition of AcpA phosphatase activity with ascorbate attenuates Francisella tularensis intramacrophage survival. J Biol Chem285:5171-7 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Acid phosphatase |
|---|
| Name: | Acid phosphatase |
|---|
| Synonyms: | Acid phosphatase (acpA) | Acid phosphatase (acpB) | Acid phosphatase (acpC) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 22350.38 |
|---|
| Organism: | Francisella tularensis |
|---|
| Description: | Q5NIC0 |
|---|
| Residue: | 194 |
|---|
| Sequence: | MTQQQVISYYESTAHENEVELILARAKKIIQAQQSLQGNAIVLDIDETALNHYYSLKLAG
FPQGENHTIWNELLSRTDAYPIKATLDFYLYCLTSGLKVFFISARFAQYLESTKQALRNA
GYVNFEDVFVFPENIEQYNSKDFKNFKAERRAYIESLGYKILISIGDQSSDLLGGYTLYT
LQLPNYLYGENSRF
|
|
|
|---|
| BDBM92476 |
|---|
| n/a |
|---|
| Name | BDBM92476 |
|---|
| Synonyms: | (+)-5,6-O-Isopropylidene-L-ascorbic acid |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C9H12O6 |
|---|
| Mol. Mass. | 216.188 |
|---|
| SMILES | CC1(C)OC[C@H](O1)[C@H]1OC(=O)C(=O)C1O |
|---|
| Structure | 
|
|---|
Search and Browse
