Reaction Details |
| Report a problem with these data |
Target | 2'-deoxynucleoside 5'-phosphate N-hydrolase 1 |
---|
Ligand | BDBM92532 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Inhibition Assay |
---|
Kd | 3.638e+5± 1.46e+4 nM |
---|
Citation | Dupouy, C; Zhang, C; Padilla, A; Pochet, S; Kaminski, PA Probing the active site of the deoxynucleotide N-hydrolase Rcl encoded by the rat gene c6orf108. J Biol Chem285:41806-14 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
2'-deoxynucleoside 5'-phosphate N-hydrolase 1 |
---|
Name: | 2'-deoxynucleoside 5'-phosphate N-hydrolase 1 |
Synonyms: | DNPH1_RAT | Deoxyribonucleoside 5'-monophosphate N-glycosidase (Rcl) | Deoxyribonucleoside 5'-monophosphate N-glycosidase (Rcl) D69N | Deoxyribonucleoside 5'-monophosphate N-glycosidase (Rcl) E93Q | Deoxyribonucleoside 5'-monophosphate N-glycosidase (Rcl) S117A | Deoxyribonucleoside 5'-monophosphate N-glycosidase (Rcl) Y13F | Dnph1 | Rcl | c-Myc-responsive protein Rcl |
Type: | Enzyme |
Mol. Mass.: | 17775.23 |
Organism: | Rattus norvegicus (Rat) |
Description: | O35820 |
Residue: | 163 |
Sequence: | MAASGEQAPCSVYFCGSIRGGREDQALYARIVSRLRRYGKVLTEHVADAELEPLGEEAAG
GDQFIHEQDLNWLQQADVVVAEVTQPSLGVGYELGRAVALGKPILCLFRPQSGRVLSAMI
RGAADGSRFQVWDYAEGEVETMLDRYFEAYLPQKTASSSHPSA
|
|
|
BDBM92532 |
---|
n/a |
---|
Name | BDBM92532 |
Synonyms: | dGMP |
Type | Small molecule |
Emp. Form. | C10H12N5O7P |
Mol. Mass. | 345.2064 |
SMILES | Nc1nc2n(cnc2c(=O)[nH]1)C1CC(O)C(COP([O-])([O-])=O)O1 |
Structure |
|