| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 2'-deoxynucleoside 5'-phosphate N-hydrolase 1 |
|---|
| Ligand | BDBM92542 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Inhibition Assay |
|---|
| Ki | 1.4e+4±n/a nM |
|---|
| Citation |  Dupouy, C; Zhang, C; Padilla, A; Pochet, S; Kaminski, PA Probing the active site of the deoxynucleotide N-hydrolase Rcl encoded by the rat gene c6orf108. J Biol Chem285:41806-14 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 2'-deoxynucleoside 5'-phosphate N-hydrolase 1 |
|---|
| Name: | 2'-deoxynucleoside 5'-phosphate N-hydrolase 1 |
|---|
| Synonyms: | DNPH1_RAT | Deoxyribonucleoside 5'-monophosphate N-glycosidase (Rcl) | Deoxyribonucleoside 5'-monophosphate N-glycosidase (Rcl) D69N | Deoxyribonucleoside 5'-monophosphate N-glycosidase (Rcl) E93Q | Deoxyribonucleoside 5'-monophosphate N-glycosidase (Rcl) S117A | Deoxyribonucleoside 5'-monophosphate N-glycosidase (Rcl) Y13F | Dnph1 | Rcl | c-Myc-responsive protein Rcl |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 17775.23 |
|---|
| Organism: | Rattus norvegicus (Rat) |
|---|
| Description: | O35820 |
|---|
| Residue: | 163 |
|---|
| Sequence: | MAASGEQAPCSVYFCGSIRGGREDQALYARIVSRLRRYGKVLTEHVADAELEPLGEEAAG
GDQFIHEQDLNWLQQADVVVAEVTQPSLGVGYELGRAVALGKPILCLFRPQSGRVLSAMI
RGAADGSRFQVWDYAEGEVETMLDRYFEAYLPQKTASSSHPSA
|
|
|
|---|
| BDBM92542 |
|---|
| n/a |
|---|
| Name | BDBM92542 |
|---|
| Synonyms: | 5'-AMPS |
|---|
| Type | Small molecule |
|---|
| Emp. Form. | C10H12N5O6PS |
|---|
| Mol. Mass. | 361.272 |
|---|
| SMILES | Nc1ncnc2n(cnc12)C1OC(COP([O-])([O-])=S)C(O)C1O |
|---|
| Structure | 
|
|---|
Search and Browse
