| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cyclin-dependent kinase 1 |
|---|
| Ligand | BDBM13534 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Radiometric Assay |
|---|
| IC50 | >10000±0 nM |
|---|
| Citation |  Scutt, PJ; Chu, ML; Sloane, DA; Cherry, M; Bignell, CR; Williams, DH; Eyers, PA Discovery and exploitation of inhibitor-resistant aurora and polo kinase mutants for the analysis of mitotic networks. J Biol Chem284:15880-93 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cyclin-dependent kinase 1 |
|---|
| Name: | Cyclin-dependent kinase 1 |
|---|
| Synonyms: | CDC2 | CDC28A | CDK1 | CDK1_HUMAN | CDKN1 | Cell division control protein 2 homolog | Cell division protein kinase 1 | Cyclin-dependent kinase 1 (CDK1) | P34CDC2 | p34 protein kinase |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 34101.08 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P06493 |
|---|
| Residue: | 297 |
|---|
| Sequence: | MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
|
|
|
|---|
| BDBM13534 |
|---|
| n/a |
|---|
| Name | BDBM13534 |
|---|
| Synonyms: | CHEMBL572878 | N-[4-({4-[(3-methyl-1H-pyrazol-5-yl)amino]-6-(4-methylpiperazin-1-yl)pyrimidin-2-yl}sulfanyl)phenyl]cyclopropanecarboxamide | N-[4-[[4-(4-methylpiperazino)-6-[(5-methyl-1H-pyrazol-3-yl)amino]pyrimidin-2-yl]thio]phenyl]cyclopropanecarboxamide | VX-680 | VX680 | cyclopropane carboxylic acid {4-[4-(4-methyl-piperazin-1-yl)-6-(5-methyl-2H-pyrazol-3-ylamino)-pyrimidin-2ylsulphanyl]-phenyl}-amide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H28N8OS |
|---|
| Mol. Mass. | 464.586 |
|---|
| SMILES | CN1CCN(CC1)c1cc(Nc2cc(C)n[nH]2)nc(Sc2ccc(NC(=O)C3CC3)cc2)n1 |
|---|
| Structure | 
|
|---|
Search and Browse
