| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Trp operon repressor |
|---|
| Ligand | BDBM92688 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Binding Assay |
|---|
| Kd | 2.77e+4±n/a nM |
|---|
| Citation |  Marmorstein, RQ; Joachimiak, A; Sprinzl, M; Sigler, PB The structural basis for the interaction between L-tryptophan and the Escherichia coli trp aporepressor. J Biol Chem262:4922-7 (1987) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Trp operon repressor |
|---|
| Name: | Trp operon repressor |
|---|
| Synonyms: | TRPR_ECOLI | Trp Aprorepressor | Trp operon repressor | rtrY | trpR |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 12353.00 |
|---|
| Organism: | Escherichia coli (strain K12) |
|---|
| Description: | P0A881 |
|---|
| Residue: | 108 |
|---|
| Sequence: | MAQQSPYSAAMAEQRHQEWLRFVDLLKNAYQNDLHLPLLNLMLTPDEREALGTRVRIVEE
LLRGEMSQRELKNELGAGIATITRGSNSLKAAPVELRQWLEEVLLKSD
|
|
|
|---|
| BDBM92688 |
|---|
| n/a |
|---|
| Name | BDBM92688 |
|---|
| Synonyms: | L-Tryptophanamide, 9 |
|---|
| Type | Small molecule |
|---|
| Emp. Form. | C11H13N3O |
|---|
| Mol. Mass. | 203.2404 |
|---|
| SMILES | NC(Cc1c[nH]c2ccccc12)C(N)=O |
|---|
| Structure | 
|
|---|
Search and Browse
